Mouse CD19 antibody (Hybridoma Clone HD37) run against V-Base


Heavy chain sequence

>gi|1435159|emb|CAA67618.1| immunoglobulin heavy chain variable domain [Mus musculus]
QVQLQQSGAELVRPGSSVKISCKASGYAFSSYWMNWVKQRPGQGLEWIGQIWPGDGDTNYNGKFKGKATL
TADESSSTAYMQLSSLASEDSAVYFCARRETTTVGRYYYAMDYWGQGTSVTVSS

Light chain sequence


>gi|1435161|emb|CAA67621.1| immunoglobulin light chain variable domain [Mus musculus]
DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATD
FTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR

Heavy Chain VH segment

Date: Fri, 21 Jul 2000 15:36:21 +0100

 TFASTA translates and searches a DNA sequence data bank
 version 3.2t07 August 17, 1999
Please cite:
 W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

/tmp/.fasta3-search-1136836: 124 aa
 >HD37H
 vs  V-Base too library
searching /data/gcgblast/v-base 0 library

 167083 residues in   638 sequences
  Expectation_n fit: rho(ln(x))= 60.5443+/- 0.011; mu= -174.9734+/- 0.484;
 mean_var=11130.1783+/-9243.552, 0's: 1 Z-trim: 0  B-trim: 0 in 0/21

TFASTA (3.27 August, 1999) function [optimized, BL50 matrix (15:-5)] ktup: 2
 join: 36, opt: 36, gap-pen: -16/ -2, width:  16 reg.-scaled
 Scan time:  0.310
The best  scores are:                             initn init1 opt z-sc E(637)
6M27                                  ( 296) [1]  465  465  465   78.0     9.8

>>6M27                                                    (296 aa)
Frame: 1 initn: 465 init1: 465 opt: 465 Z-score: 78.0 expect()  9.8
 69.388% identity in 98 aa overlap (1-98:1-294)

               10        20        30        40        50        60
HD37H  QVQLQQSGAELVRPGSSVKISCKASGYAFSSYWMNWVKQRPGQGLEWIGQIWPGDGDTNY
       :::: :::::. .::::::.:::::: .:::: ..::.: :::::::.:.: :  : .::
6M27   QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGRIIPILGTANY
         10        40        70       100       130       160      

               70        80        90       100       110       120
HD37H  NGKFKGKATLTADESSSTAYMQLSSLASEDSAVYFCARRETTTVGRYYYAMDYWGQGTSV
         ::.:..:.:::::.:::::.:::: :::.:::.:::                      
6M27   AQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR                      
        190       220       250       280                          

           
HD37H  TVSS



124 residues in 1 query   sequences
167083 residues in 638 library sequences
 Tcomplib (4 proc)[version 3.2t07 August 17, 1999]
 start: Fri Jul 21 15:36:21 2000 done: Fri Jul 21 15:36:21 2000
 Scan time:  0.310 Display time:  0.010

Function used was  TFASTA 

Heavy Chain JH Segment

Date: Fri, 21 Jul 2000 15:43:09 +0100
Subject: FASTA results: HD37HJ

 TFASTA translates and searches a DNA sequence data bank
 version 3.2t07 August 17, 1999
Please cite:
 W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

/tmp/.fasta3-search-1158756: 26 aa
 >HD37HJ
 vs  V-Base too library
searching /data/gcgblast/v-base 0 library

 167083 residues in   638 sequences
  Expectation_n fit: rho(ln(x))= 3.0928+/-0.00779; mu= 6.5481+/- 0.438;
 mean_var=13.7628+/- 9.343, 0's: 2 Z-trim: 11  B-trim: 2 in 1/18

TFASTA (3.27 August, 1999) function [optimized, BL50 matrix (15:-5)] ktup: 2
 join: 36, opt: 36, gap-pen: -16/ -2, width:  16 reg.-scaled
 Scan time:  0.160
The best  scores are:                             initn init1 opt z-sc E(625)
JH6A                                  (  63) [3]  108  108  108  288.9 1.7e-11
JH6B                                  (  63) [3]  108  108  108  288.9 1.7e-11
JH6C                                  (  63) [3]  101  101  101  270.1 1.9e-10
JH4D                                  (  48) [3]   81   81   81  218.4 1.5e-07
JH4B                                  (  48) [3]   81   81   81  218.4 1.5e-07
JH4A                                  (  48) [3]   81   81   81  218.4 1.5e-07
JH3B                                  (  50) [2]   66   66   78  210.0 4.3e-07
JH3A                                  (  50) [2]   66   66   78  210.0 4.3e-07
JH2                                   (  53) [2]   59   59   74  198.7 1.8e-06
JH5A                                  (  51) [3]   65   65   71  191.0 4.9e-06
JH5B                                  (  51) [3]   65   65   70  188.3   7e-06
JH1                                   (  52) [1]   65   65   67  180.0   2e-05

>>JH6A                                                    (63 aa)
Frame: 3 initn: 108 init1: 108 opt: 108 Z-score: 288.9 expect() 1.7e-11
 83.333% identity in 18 aa overlap (9-26:9-62)

               10        20      
HD37HJ RETTTVGRYYYAMDYWGQGTSVTVSS
               :::.:: :::::.:::::
JH6A         YYYYYGMDVWGQGTTVTVSS
                     30        60

>>JH6B                                                    (63 aa)
Frame: 3 initn: 108 init1: 108 opt: 108 Z-score: 288.9 expect() 1.7e-11
 83.333% identity in 18 aa overlap (9-26:9-62)

               10        20      
HD37HJ RETTTVGRYYYAMDYWGQGTSVTVSS
               :::.:: :::::.:::::
JH6B         YYYYYGMDVWGQGTTVTVSS
                     30        60

>>JH6C                                                    (63 aa)
Frame: 3 initn: 101 init1: 101 opt: 101 Z-score: 270.1 expect() 1.9e-10
 77.778% identity in 18 aa overlap (9-26:9-62)

               10        20      
HD37HJ RETTTVGRYYYAMDYWGQGTSVTVSS
               ::: :: ::.::.:::::
JH6C         YYYYYYMDVWGKGTTVTVSS
                     30        60

>>JH4D                                                    (48 aa)
Frame: 3 initn:  81 init1:  81 opt:  81 Z-score: 218.4 expect() 1.5e-07
 92.308% identity in 13 aa overlap (14-26:9-47)

               10        20      
HD37HJ RETTTVGRYYYAMDYWGQGTSVTVSS
                    ::::::: :::::
JH4D              YFDYWGQGTLVTVSS
                          30     

>>JH4B                                                    (48 aa)
Frame: 3 initn:  81 init1:  81 opt:  81 Z-score: 218.4 expect() 1.5e-07
 92.308% identity in 13 aa overlap (14-26:9-47)

               10        20      
HD37HJ RETTTVGRYYYAMDYWGQGTSVTVSS
                    ::::::: :::::
JH4B              YFDYWGQGTLVTVSS
                          30     

>>JH4A                                                    (48 aa)
Frame: 3 initn:  81 init1:  81 opt:  81 Z-score: 218.4 expect() 1.5e-07
 92.308% identity in 13 aa overlap (14-26:9-47)

               10        20      
HD37HJ RETTTVGRYYYAMDYWGQGTSVTVSS
                    ::::::: :::::
JH4A              YFDYWGQGTLVTVSS
                          30     

>>JH3B                                                    (50 aa)
Frame: 2 initn:  66 init1:  66 opt:  78 Z-score: 210.0 expect() 4.3e-07
 80.000% identity in 15 aa overlap (12-26:5-49)

               10        20      
HD37HJ RETTTVGRYYYAMDYWGQGTSVTVSS
                  :.: ::::: :::::
JH3B             DAFDIWGQGTMVTVSS
                      20         

>>JH3A                                                    (50 aa)
Frame: 2 initn:  66 init1:  66 opt:  78 Z-score: 210.0 expect() 4.3e-07
 80.000% identity in 15 aa overlap (12-26:5-49)

               10        20      
HD37HJ RETTTVGRYYYAMDYWGQGTSVTVSS
                  :.: ::::: :::::
JH3A             DAFDVWGQGTMVTVSS
                      20         

>>JH2                                                     (53 aa)
Frame: 2 initn:  59 init1:  59 opt:  74 Z-score: 198.7 expect() 1.8e-06
 64.706% identity in 17 aa overlap (10-26:2-52)

               10        20      
HD37HJ RETTTVGRYYYAMDYWGQGTSVTVSS
                :. .: ::.:: :::::
JH2             YWYFDLWGRGTLVTVSS
                     20        50

>>JH5A                                                    (51 aa)
Frame: 3 initn:  65 init1:  65 opt:  71 Z-score: 191.0 expect() 4.9e-06
 84.615% identity in 13 aa overlap (14-26:12-50)

               10        20      
HD37HJ RETTTVGRYYYAMDYWGQGTSVTVSS
                    : ::::: :::::
JH5A             NWFDSWGQGTLVTVSS
                         30      

>>JH5B                                                    (51 aa)
Frame: 3 initn:  65 init1:  65 opt:  70 Z-score: 188.3 expect() 7e-06
 84.615% identity in 13 aa overlap (14-26:12-50)

               10        20      
HD37HJ RETTTVGRYYYAMDYWGQGTSVTVSS
                    : ::::: :::::
JH5B             NWFDPWGQGTLVTVSS
                         30      

>>JH1                                                     (52 aa)
Frame: 1 initn:  65 init1:  65 opt:  67 Z-score: 180.0 expect() 2e-05
 83.333% identity in 12 aa overlap (15-26:16-51)

               10        20      
HD37HJ RETTTVGRYYYAMDYWGQGTSVTVSS
                     .::::: :::::
JH1             AEYFQHWGQGTLVTVSS
                  10        40   


26 residues in 1 query   sequences
167083 residues in 638 library sequences
 Tcomplib (4 proc)[version 3.2t07 August 17, 1999]
 start: Fri Jul 21 15:43:09 2000 done: Fri Jul 21 15:43:09 2000
 Scan time:  0.160 Display time:  0.020

Function used was  TFASTA 

Light Chain VL segment

Date: Fri, 21 Jul 2000 15:37:25 +0100
Subject: FASTA results: HD37L

 TFASTA translates and searches a DNA sequence data bank
 version 3.2t07 August 17, 1999
Please cite:
 W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

/tmp/.fasta3-search-1162793: 108 aa
 >HD37L
 vs  V-Base too library
searching /data/gcgblast/v-base 0 library

 167083 residues in   638 sequences
  Expectation_n fit: rho(ln(x))= 39.2494+/-0.0122; mu= -115.2375+/- 0.562;
 mean_var=11462.3488+/-10004.814, 0's: 1 Z-trim: 0  B-trim: 0 in 0/21

TFASTA (3.27 August, 1999) function [optimized, BL50 matrix (15:-5)] ktup: 2
 join: 36, opt: 36, gap-pen: -16/ -2, width:  16 reg.-scaled
 Scan time:  0.250
The best  scores are:                             initn init1 opt z-sc E(637)
DPK9_O12-                             ( 287) [1]  424  424  432   80.4     7.2
L10A                                  ( 290) [1]  349  262  425   79.7     7.9
DPK7_HK134-                           ( 287) [1]  423  423  423   79.5     8.1
V3B                                   ( 287) [1]  414  414  422   79.4     8.2
V268                                  ( 290) [1]  344  262  420   79.2     8.4
DPK23_L25-                            ( 290) [1]  344  262  420   79.2     8.4
DPK6_VB                               ( 287) [1]  369  369  419   79.2     8.4
VB                                    ( 287) [1]  369  369  419   79.2     8.4
DPK5_VB                               ( 287) [1]  369  369  419   79.2     8.4
DPK1_O18-                             ( 287) [1]  379  379  417   79.0     8.7
HK101_HK146-                          ( 287) [1]  417  417  417   79.0     8.7
V108                                  ( 287) [1]  368  368  416   78.9     8.8
VG_38K-                               ( 287) [1]  368  368  416   78.9     8.8
VE                                    ( 287) [1]  412  412  416   78.9     8.8
HK137                                 ( 287) [1]  414  414  414   78.7       9
DPK8_VD                               ( 287) [1]  412  412  412   78.5     9.2
DPK3_L11                              ( 287) [1]  406  406  411   78.4     9.3
DPK24_VKIVKLOB-                       ( 305) [1]  388  301  413   78.4     9.3
LFVK431                               ( 287) [1]  410  410  410   78.3     9.4
VH                                    ( 290) [1]  336  249  408   78.1     9.7

>>DPK9_O12-                                               (287 aa)
Frame: 1 initn: 424 init1: 424 opt: 432 Z-score: 80.4 expect()  7.2
 64.211% identity in 95 aa overlap (1-95:1-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
       :: .::::.:.: :::.:::.::.::... .:..:::::: ..::::::.::.  .:::.
DPK9_O DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       ::.::::.:::::::::.: ::.: :.: :.:: :             
DPK9_O RFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTP             
        190       220       250       280              

>>L10A                                                    (290 aa)
Frame: 1 initn: 349 init1: 262 opt: 425 Z-score: 79.7 expect()  7.9
 64.583% identity in 96 aa overlap (1-95:1-288)

               10        20         30        40        50         
HD37L  DILITQSPKSMSMSVGERVTLTCKASENV-VTYVSWYQQKPEQSPKLLIYGASNRYTGVP
       .:..:::: ..:.: ::::::.:.::..:  .:.::::::: :.:.:::::::.: ::.:
L10A   EIVMTQSPPTLSLSPGERVTLSCRASQSVSSSYLSWYQQKPGQAPRLLIYGASTRATGIP
         10        40        70       100       130       160      

      60        70        80        90       100        
HD37L  DRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
        ::.::::.:::::::::.: ::.: :.: : :. :             
L10A   ARFSGSGSGTDFTLTISSLQPEDFAVYYCQQDYNLP             
        190       220       250       280               

>>DPK7_HK134-                                             (287 aa)
Frame: 1 initn: 423 init1: 423 opt: 423 Z-score: 79.5 expect()  8.1
 63.158% identity in 95 aa overlap (1-95:1-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
       :: .::::.:.: :::.:::.::.::... ....:::::::..:: :::.::.  .:::.
DPK7_H DIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPEKAPKSLIYAASSLQSGVPS
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       ::.::::.:::::::::.: ::.: :.: :  :::             
DPK7_H RFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYP             
        190       220       250       280              

>>V3B                                                     (287 aa)
Frame: 1 initn: 414 init1: 414 opt: 422 Z-score: 79.4 expect()  8.2
 63.158% identity in 95 aa overlap (1-95:1-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
       :: .::::. .: :::.:::.::.::... .:..:::::: ..::::::.::.  .:::.
V3B    DIQMTQSPSFLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       ::.::::.:::::::::.: ::.: :.:  ::: :             
V3B    RFSGSGSGTDFTLTISSLQPEDFATYYCQCGYSTP             
        190       220       250       280              

>>V268                                                    (290 aa)
Frame: 1 initn: 344 init1: 262 opt: 420 Z-score: 79.2 expect()  8.4
 63.542% identity in 96 aa overlap (1-95:1-288)

               10        20         30        40        50         
HD37L  DILITQSPKSMSMSVGERVTLTCKASENV-VTYVSWYQQKPEQSPKLLIYGASNRYTGVP
       .:..:::: ..:.: :::.::.:.::..:  .:.::::::: :.:.:::::::.: ::.:
V268   EIVMTQSPATLSLSPGERATLSCRASQSVSSSYLSWYQQKPGQAPRLLIYGASTRATGIP
         10        40        70       100       130       160      

      60        70        80        90       100        
HD37L  DRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
        ::.::::.:::::::::.: ::.: :.: : :. :             
V268   ARFSGSGSGTDFTLTISSLQPEDFAVYYCQQDYNLP             
        190       220       250       280               

>>DPK23_L25-                                              (290 aa)
Frame: 1 initn: 344 init1: 262 opt: 420 Z-score: 79.2 expect()  8.4
 63.542% identity in 96 aa overlap (1-95:1-288)

               10        20         30        40        50         
HD37L  DILITQSPKSMSMSVGERVTLTCKASENV-VTYVSWYQQKPEQSPKLLIYGASNRYTGVP
       .:..:::: ..:.: :::.::.:.::..:  .:.::::::: :.:.:::::::.: ::.:
DPK23_ EIVMTQSPATLSLSPGERATLSCRASQSVSSSYLSWYQQKPGQAPRLLIYGASTRATGIP
         10        40        70       100       130       160      

      60        70        80        90       100        
HD37L  DRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
        ::.::::.:::::::::.: ::.: :.: : :. :             
DPK23_ ARFSGSGSGTDFTLTISSLQPEDFAVYYCQQDYNLP             
        190       220       250       280               

>>DPK6_VB                                                 (287 aa)
Frame: 1 initn: 369 init1: 369 opt: 419 Z-score: 79.2 expect()  8.4
 62.105% identity in 95 aa overlap (1-95:1-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
       :: .::::.:.: :::.:::.::.::... ....:::::: ..::::::.::.  .:::.
DPK6_V DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPS
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       ::.::::.:::::::::.: ::.: :.: :. :.:             
DPK6_V RFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFP             
        190       220       250       280              

>>VB                                                      (287 aa)
Frame: 1 initn: 369 init1: 369 opt: 419 Z-score: 79.2 expect()  8.4
 62.105% identity in 95 aa overlap (1-95:1-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
       :: .::::.:.: :::.:::.::.::... ....:::::: ..::::::.::.  .:::.
VB     DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPS
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       ::.::::.:::::::::.: ::.: :.: :. :.:             
VB     RFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFP             
        190       220       250       280              

>>DPK5_VB                                                 (287 aa)
Frame: 1 initn: 369 init1: 369 opt: 419 Z-score: 79.2 expect()  8.4
 62.105% identity in 95 aa overlap (1-95:1-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
       :: .::::.:.: :::.:::.::.::... ....:::::: ..::::::.::.  .:::.
DPK5_V DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPS
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       ::.::::.:::::::::.: ::.: :.: :. :.:             
DPK5_V RFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFP             
        190       220       250       280              

>>DPK1_O18-                                               (287 aa)
Frame: 1 initn: 379 init1: 379 opt: 417 Z-score: 79.0 expect()  8.7
 63.158% identity in 95 aa overlap (1-95:1-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
       :: .::::.:.: :::.:::.::.::... .:..:::::: ..:::::: :::  ::::.
DPK1_O DIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPS
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       ::.::::.::::.::::.: ::.: :.: :  . :             
DPK1_O RFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLP             
        190       220       250       280              

>>HK101_HK146-                                            (287 aa)
Frame: 1 initn: 417 init1: 417 opt: 417 Z-score: 79.0 expect()  8.7
 62.105% identity in 95 aa overlap (1-95:1-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
       :: .::::.:.: :::.:::.::.: ... ....:::::::..:: :::.::.  .:::.
HK101_ DIQMTQSPSSLSASVGDRVTITCRARQGISSWLAWYQQKPEKAPKSLIYAASSLQSGVPS
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       ::.::::.:::::::::.: ::.: :.: :  :::             
HK101_ RFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYP             
        190       220       250       280              

>>V108                                                    (287 aa)
Frame: 1 initn: 368 init1: 368 opt: 416 Z-score: 78.9 expect()  8.8
 63.158% identity in 95 aa overlap (1-95:1-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
       :: .::::.:.: :::.:::.::.::... . .::::::: :.: ::::.::.  .:::.
V108   DIQVTQSPSSLSASVGDRVTITCRASQGISNGLSWYQQKPGQAPTLLIYAASSLQSGVPS
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       ::.::::.:::::::::.: ::.: :.: : :. :             
V108   RFSGSGSGTDFTLTISSLQPEDVATYYCLQDYTTP             
        190       220       250       280              

>>VG_38K-                                                 (287 aa)
Frame: 1 initn: 368 init1: 368 opt: 416 Z-score: 78.9 expect()  8.8
 61.053% identity in 95 aa overlap (1-95:1-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
       .:..:::: ..:.: :::.::.:.::..: .:..:::::: :.:.:::: :::: ::.: 
VG_38K EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       ::.::::.:::::::::.. ::.: :.: :  ..:             
VG_38K RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWP             
        190       220       250       280              

>>VE                                                      (287 aa)
Frame: 1 initn: 412 init1: 412 opt: 416 Z-score: 78.9 expect()  8.8
 62.766% identity in 94 aa overlap (2-95:4-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
        : .::::.:.: :.:.:::.::.::... .:..:::::: ..::::::.::.  .:::.
VE     AIRMTQSPSSFSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPS
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       ::.::::.:::::::: .:.::.: :.: : ::::             
VE     RFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSYP             
        190       220       250       280              

>>HK137                                                   (287 aa)
Frame: 1 initn: 414 init1: 414 opt: 414 Z-score: 78.7 expect()    9
 62.105% identity in 95 aa overlap (1-95:1-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
       :: .::::.:.: :::.:::.::.::... .:..:.:::: ..:: :::.::.  .:::.
HK137  DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWFQQKPGKAPKSLIYAASSLQSGVPS
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       ::.::::.:::::::::.: ::.: :.: :  :::             
HK137  RFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYP             
        190       220       250       280              

>>DPK8_VD                                                 (287 aa)
Frame: 1 initn: 412 init1: 412 opt: 412 Z-score: 78.5 expect()  9.2
 62.105% identity in 95 aa overlap (1-95:1-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
       :: .::::. .: :::.:::.::.::... .:..:::::: ..::::::.::.  .:::.
DPK8_V DIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPS
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       ::.::::.:.:::::::.: ::.: :.: :  :::             
DPK8_V RFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYP             
        190       220       250       280              

>>DPK3_L11                                                (287 aa)
Frame: 1 initn: 406 init1: 406 opt: 411 Z-score: 78.4 expect()  9.3
 62.766% identity in 94 aa overlap (2-95:4-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
        : .::::.:.: :::.:::.::.::... . ..:::::: ..::::::.::.  .:::.
DPK3_L AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPS
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       ::.::::.:::::::::.: ::.: :.: : :.::             
DPK3_L RFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYP             
        190       220       250       280              

>>DPK24_VKIVKLOB-                                         (305 aa)
Frame: 1 initn: 388 init1: 301 opt: 413 Z-score: 78.4 expect()  9.3
 62.376% identity in 101 aa overlap (1-95:1-303)

               10        20        30              40        50    
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVV------TYVSWYQQKPEQSPKLLIYGASNR
       ::..:::: :...:.:::.:..::.:..:.      .:..:::::: : :::::: ::.:
DPK24_ DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWASTR
         10        40        70       100       130       160      

           60        70        80        90       100        
HD37L  YTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
        .::::::.::::.:::::::::.::::.: :.: : :: :             
DPK24_ ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTP             
        190       220       250       280                    

>>LFVK431                                                 (287 aa)
Frame: 1 initn: 410 init1: 410 opt: 410 Z-score: 78.3 expect()  9.4
 61.053% identity in 95 aa overlap (1-95:1-285)

               10        20        30        40        50        60
HD37L  DILITQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
       :: .::::.:.: :::.:::.::.::... .:..:.:::: ..:: :::.::.  .:::.
LFVK43 DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWFQQKPGKAPKSLIYAASSLQSGVPS
         10        40        70       100       130       160      

               70        80        90       100        
HD37L  RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
       .:.::::.:::::::::.: ::.: :.: :  :::             
LFVK43 KFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYP             
        190       220       250       280              

>>VH                                                      (290 aa)
Frame: 1 initn: 336 init1: 249 opt: 408 Z-score: 78.1 expect()  9.7
 61.458% identity in 96 aa overlap (1-95:1-288)

               10        20         30        40        50         
HD37L  DILITQSPKSMSMSVGERVTLTCKASENV-VTYVSWYQQKPEQSPKLLIYGASNRYTGVP
       .:..:::: ..:.: ::::::.:.::..:  .:..:::::: :.:.:::::::.: :..:
VH     EIVMTQSPPTLSLSPGERVTLSCRASQSVSSSYLTWYQQKPGQAPRLLIYGASTRATSIP
         10        40        70       100       130       160      

      60        70        80        90       100        
HD37L  DRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKR
        ::.::::.:::::::::.: ::.: :.: : .. :             
VH     ARFSGSGSGTDFTLTISSLQPEDFAVYYCQQDHNLP             
        190       220       250       280               



108 residues in 1 query   sequences
167083 residues in 638 library sequences
 Tcomplib (4 proc)[version 3.2t07 August 17, 1999]
 start: Fri Jul 21 15:37:24 2000 done: Fri Jul 21 15:37:25 2000
 Scan time:  0.250 Display time:  0.040

Function used was  TFASTA 

Light Chain JK segment

Date: Fri, 21 Jul 2000 15:42:05 +0100
Subject: FASTA results: HD37LJ

 TFASTA translates and searches a DNA sequence data bank
 version 3.2t07 August 17, 1999
Please cite:
 W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

/tmp/.fasta3-search-1156404: 13 aa
 >HD37LJ
 vs  V-Base too library
searching /data/gcgblast/v-base 0 library

 167083 residues in   638 sequences
  Expectation_n fit: rho(ln(x))= 2.7859+/-0.00771; mu= 4.0855+/- 0.433;
 mean_var=14.2928+/-11.555, 0's: 11 Z-trim: 9  B-trim: 5 in 1/20

TFASTA (3.27 August, 1999) function [optimized, BL50 matrix (15:-5)] ktup: 2
 join: 36, opt: 36, gap-pen: -16/ -2, width:  16 reg.-scaled
 Scan time:  0.140
The best  scores are:                             initn init1 opt z-sc E(618)
JK2                                   (  39) [3]   68   68   68  192.1 4.2e-06
JK4                                   (  38) [2]   66   66   66  187.0 8.2e-06
JK1                                   (  38) [2]   56   56   58  165.8 0.00012
JK5                                   (  38) [2]   57   57   57  163.2 0.00017
JK3                                   (  38) [2]   52   52   56  160.5 0.00024

>>JK2                                                     (39 aa)
Frame: 3 initn:  68 init1:  68 opt:  68 Z-score: 192.1 expect() 4.2e-06
 91.667% identity in 12 aa overlap (1-12:3-38)

               10   
HD37LJ YTFGGGTKLEIKR
       :::: ::::::: 
JK2    YTFGQGTKLEIK 
               30   

>>JK4                                                     (38 aa)
Frame: 2 initn:  66 init1:  66 opt:  66 Z-score: 187.0 expect() 8.2e-06
 90.909% identity in 11 aa overlap (2-12:5-37)

               10   
HD37LJ YTFGGGTKLEIKR
        :::::::.::: 
JK4    LTFGGGTKVEIK 
            20      

>>JK1                                                     (38 aa)
Frame: 2 initn:  56 init1:  56 opt:  58 Z-score: 165.8 expect() 0.00012
 75.000% identity in 12 aa overlap (1-12:2-37)

               10   
HD37LJ YTFGGGTKLEIKR
       .::: :::.::: 
JK1    WTFGQGTKVEIK 
            20      

>>JK5                                                     (38 aa)
Frame: 2 initn:  57 init1:  57 opt:  57 Z-score: 163.2 expect() 0.00017
 81.818% identity in 11 aa overlap (2-12:5-37)

               10   
HD37LJ YTFGGGTKLEIKR
        ::: ::.:::: 
JK5    ITFGQGTRLEIK 
            20      

>>JK3                                                     (38 aa)
Frame: 2 initn:  52 init1:  52 opt:  56 Z-score: 160.5 expect() 0.00024
 66.667% identity in 12 aa overlap (1-12:2-37)

               10   
HD37LJ YTFGGGTKLEIKR
       .::: :::..:: 
JK3    FTFGPGTKVDIK 
            20      


13 residues in 1 query   sequences
167083 residues in 638 library sequences
 Tcomplib (4 proc)[version 3.2t07 August 17, 1999]
 start: Fri Jul 21 15:42:05 2000 done: Fri Jul 21 15:42:05 2000
 Scan time:  0.140 Display time:  0.010

Function used was  TFASTA 

This page is from   Mike Clark
"An antibody engineer who also enjoys the mountains."
mrc7@cam.ac.uk
Mike's home-page

© Mike Clark, PhD., Cambridge University, UK
Last updated on 21st July 2000